PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G309200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 656aa    MW: 70783.4 Da    PI: 4.3514
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G309200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.42.3e-52271551129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         l+pGfrFhPtdeelv++yLk+kv g++l++ ++i+evd+yk+ePwdLp+  ++++++++wyfFs+ d+k+a+  r+nrat+ gyWk+tgkd
  Brast03G309200.1.p  27 LAPGFRFHPTDEELVSYYLKRKVLGRPLKV-DAIAEVDLYKLEPWDLPArsRLRSRDSQWYFFSRLDRKHANRARTNRATAGGYWKTTGKD 116
                         579***************************.99***************4357888999********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +ev + +  + g+kktLvf++grapkge+t+Wvmheyrle
  Brast03G309200.1.p 117 REVRH-GPMVAGMKKTLVFHSGRAPKGERTNWVMHEYRLE 155
                         *****.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-6025175IPR003441NAC domain
PROSITE profilePS5100558.34227175IPR003441NAC domain
PfamPF023653.3E-2829154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 656 aa     Download sequence    Send to blast
MTRPSSSSSP APAAAPAPAE PDDPTSLAPG FRFHPTDEEL VSYYLKRKVL GRPLKVDAIA  60
EVDLYKLEPW DLPARSRLRS RDSQWYFFSR LDRKHANRAR TNRATAGGYW KTTGKDREVR  120
HGPMVAGMKK TLVFHSGRAP KGERTNWVMH EYRLEGDGAA GIPQDSFVVC RIFQKAGPGP  180
QNGAQYGAPF VEEEWDADDV GLMPVEGDAD VDAEREATGA MEKGYLQMSD LIQDWDGQNE  240
NGGVALPGSD TSNNSNQSEV AEGNSGDILN DPNLGSNFVQ YVDPGEQNSL MLNENMLSNA  300
SGGDLLNSSS PSNAFMELKD LGYPFSNDST AWPSGGWDWK PGNLELVNGA SNEAPPITGE  360
HIFQPDELEQ LLQSLQDDSP LGSTITDVPQ SSITNSVQPE DDFLMFHDAP FDSTMFNDGF  420
GQSAGFLGSS VTNLSGIGMV DDGMPYYDAI DDNSFNDMLC SGQQSAGSGS HLFNGPVLSQ  480
EVNNTSYTYS PTQKVLEPNF VVGAPSSARL PEAGSQLNCN LPDAPARRGA IVNHFVKVLD  540
SITGPNAFAS EFPPNLRKSL APISGAHPNT ISVSTEVISM EKGSLTVASR QDKWSFQKGE  600
DMELLFSTGS EPGTRMHYGG CNTVTAVLRS GFCLFFLSAI MLLVSCEVGL CIYGK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-452617514168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573214.10.0PREDICTED: NAC domain-containing protein 53-like
TrEMBLI1I0150.0I1I015_BRADI; Uncharacterized protein
STRINGBRADI3G12470.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP71073650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.12e-82NAC domain containing protein 2